Translate a nucleotide (DNA/RNA) sequence to a protein sequence

Re:Translate a nucleotide (DNA/RNA) sequence to a protein se... by davecap1 on Wednesday November 20, 2013 @12:56PM (#6769659)

It's relatively simple actually. It just what's called a "codon map" to map "codons" (3 letter sequences) to amino acids (the building blocks of proteins), just as ribosomes do in cells. Here's a codon map for example: http://patentimages.storage.googleapis.com/WO2000052183A1/im...

[ Parent | on HN ]

Re:Translate a nucleotide (DNA/RNA) sequence to a protein se... by wuschel on Wednesday November 20, 2013 @01:09PM (#6769753)

I agree: A bit more background information would be good. But I confess I am interested.

I fooled around a bit with a nucleotide sequence of Homo sapiens mRNA for prepro cortistatin like peptide, complete cds.|len=368, as taken from http://www.genomatix.de/online_help/help/sequence_formats.ht...

ACAAGATGCCATTGTCCCCCGGCCTCCTGCTGCTGCTGCTCTCCGGGGCCACGGCCACCGCTGCCCTGCC CCTGGAGGGTGGCCCCACCGGCCGAGACAGCGAGCATATGCAGGAAGCGGCAGGAATAAGGAAAAGCAGC CTCCTGACTTTCCTCGCTTGGTGGTTTGAGTGGACCTCCCAGGCCAGTGCCGGGCCCCTCATAGGAGAGG AAGCTCGGGAGGTGGCCAGGCGGCAGGAAGGCGCACCCCCCCAGCAATCCGCGCGCCGGGACAGAATGCC CTGCAGGAACTTCTTCTGGAAGACCTTCTCCTCCTGCAAATAAAACCTCACCCATGAATGCTCACGCAAG TTTAATTACAGACCTGAA

After some (random) clicking on some nucleotide spots this sequence got me this, assuming that the "standard" genetic code handles homo sapiens mRNA:

ID VIRT5672 Unreviewed; 66 AA. AC VIRT5672; DE Translation of nucleotide sequence generated on ExPASy DE on 20-Nov-2013 by 87.150.48.254. CC -!- This virtual protein sequence will automatically be deleted CC from the server after a few days. DR SWISS-2DPAGE; VIRT5672; VIRTUAL. SQ SEQUENCE 66 AA; 6E48167C288239C3 CRC64. GARHWPGRST QTTKRGKSGG CFSLFLPLPA YARCLGRWGH PPGAGQRWPW PRRAAAAGGR GTMASC //

Sequence in FASTA format

>VIRT5672 GARHWPGRSTQTTKRGKSGGCFSLFLPLPAYARCLGRWGHPPGAGQRWPWPRRAAAAGGR GTMASC

What (concrete) applications does it have except being a theoretical transcoder?

[ Parent | on HN ]

Re:Translate a nucleotide (DNA/RNA) sequence to a protein se... by sp332 on Wednesday November 20, 2013 @01:24PM (#6769889)

Does IUPAC use 'T' to stand for uracil in RNA? I always used 'U'.

[ Parent | on HN ]

Re:Translate a nucleotide (DNA/RNA) sequence to a protein se... by merry-year on Wednesday November 20, 2013 @01:10PM (#6769757)

Hmmm, are you saying that you can predict the exact protein that, say a human cell, will produce for every DNA sequence. I had the impression that the whole mRNA + ribosomes process is extremely complex and poorly understood.

[ Parent | on HN ]

Re:Translate a nucleotide (DNA/RNA) sequence to a protein se... by shiven on Wednesday November 20, 2013 @01:39PM (#6770029)

You are thinking of splicing. http://en.wikipedia.org/wiki/RNA_splicing

And, you are right. DNA => mRNA ≠ Protein, in a direct manner because of it.

[ Parent | on HN ]