New Protein Therapy Shows Promise as Antidote for Carbon Monoxide Poisoning

Re:New Protein Therapy Shows Promise as Antidote for Carbon ... by jfarlow on Thursday August 14, 2025 @11:55AM (#44901970)

Here's the full sequence of the protein, found in the supplement [1]

KSSEPASVSAAERRAETEQHKLEQENPGIVWLDQHGRVTAENDVALQILGPAGEQSLGVAQDSLEGIDVVQLHPEKSRDKLRFLLQSKDVGGSPVKSPPPVAMMINIPDRILMIKVSSMIAAGGASGTSMIFYDVTDLTTEPSGLPAGGSAPSHHHHHH

It is a protein encoding the PxRcoM-1 heme binding domain with C94S mutation and a C-terminal 6xHis tag (RcoM-HBD-C94S)

[1] https://www.pnas.org/doi/10.1073/pnas.2501389122#supplementa...

[ Parent | on HN ]

Re:New Protein Therapy Shows Promise as Antidote for Carbon ... by sunrunner on Thursday August 14, 2025 @02:10PM (#44903701)

This looks like an puzzle input to a day from Advent of Code.

[ Parent | on HN ]

Re:New Protein Therapy Shows Promise as Antidote for Carbon ... by meisel on Thursday August 14, 2025 @02:10PM (#44903716)

Thanks for that sequence, I can really picture it now

[ Parent | on HN ]

Re:New Protein Therapy Shows Promise as Antidote for Carbon ... by dekhn on Thursday August 14, 2025 @03:11PM (#44904384)

You can search for it here: https://alphafold.ebi.ac.uk/search/sequence/KSSEPASVSAAERRAE... and in principle get the AlphaFold predicted structure (I couldn't find an experimentally determined one). However, like nearly all EBI resources, the web server timed out before I could get a link to the prediction.

[ Parent | on HN ]

Re:New Protein Therapy Shows Promise as Antidote for Carbon ... by immibis on Thursday August 14, 2025 @04:25PM (#44905245)

Isn't it strange to see protein codes spreading the same way magnet links or AACS encryption keys might.

[ Parent | on HN ]

Re:New Protein Therapy Shows Promise as Antidote for Carbon ... by winocm on Thursday August 14, 2025 @05:38PM (#44906000)

If you want to download SARS-CoV-2, here you go: https://www.ncbi.nlm.nih.gov/nuccore/NC_045512.2

[ Parent | on HN ]

Re:New Protein Therapy Shows Promise as Antidote for Carbon ... by mhb on Thursday August 14, 2025 @03:14PM (#44904418)

That doesn't look right. I think the problem is in the last quarter. Exercise for the reader.

[ Parent | on HN ]

Re:New Protein Therapy Shows Promise as Antidote for Carbon ... by BurningFrog on Thursday August 14, 2025 @10:16PM (#44907909)

How hard is it to manufacture once you know the sequence?

[ Parent | on HN ]